PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g103050.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 655aa    MW: 72605.1 Da    PI: 6.5844
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g103050.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3727.6e-23128228198
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++ +++a+e+       +++    ++l+  d++g++W +++i+r++++r++lt+GW+ Fv+a++L +gD ++F  
  Sopim01g103050.0.1 128 FCKTLTASDTSTHGGFSVLRRHADEClppldmsQQP--PWQELVASDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSAKKLVAGDAFIFL- 215
                         99****************************964333..4459************************************************. PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                          + +++el+v+v+r
  Sopim01g103050.0.1 216 -RGDSGELRVGVRR 228
                         .348999*****97 PP

2Auxin_resp114.69.1e-38254336183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+ t++ F+v+Y+Pr+s+seF+v+v+k+++a ++k+svGmRfkm+fe+e+++err+sGt+vgv d  ++rWp+S+WrsLk
  Sopim01g103050.0.1 254 ASHAIMTGTLFSVFYKPRTSQSEFIVSVNKYLEARNHKLSVGMRFKMRFEGEEVPERRFSGTIVGVGDNPSSRWPDSEWRSLK 336
                         689******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-43117257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.9E-40125243IPR015300DNA-binding pseudobarrel domain
CDDcd100173.45E-20126228No hitNo description
PfamPF023628.4E-21128228IPR003340B3 DNA binding domain
SMARTSM010191.0E-20128230IPR003340B3 DNA binding domain
PROSITE profilePS5086311.166128230IPR003340B3 DNA binding domain
PfamPF065075.0E-36254336IPR010525Auxin response factor
PfamPF023092.8E-6532576IPR033389AUX/IAA domain
PROSITE profilePS5174526.465540633IPR000270PB1 domain
SuperFamilySSF542772.94E-12542617No hitNo description
PfamPF023097.7E-7583631IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MAHVAANHFG GGTHPGASAN NALYKELWHA CAGPLVTVPR EGERVYYFPQ GHMEQLEAST  60
HQGVDQHLPS FNLPAKILCK VMNVQLRAES ETDEVYAQIT LLPEPDQGEI TSPDPPLPEP  120
EKCTVHSFCK TLTASDTSTH GGFSVLRRHA DECLPPLDMS QQPPWQELVA SDLHGNEWHF  180
RHIFRGQPRR HLLTTGWSVF VSAKKLVAGD AFIFLRGDSG ELRVGVRRLM RQLNNMPSSV  240
ISSHSMHLGV LATASHAIMT GTLFSVFYKP RTSQSEFIVS VNKYLEARNH KLSVGMRFKM  300
RFEGEEVPER RFSGTIVGVG DNPSSRWPDS EWRSLKVHWD EPSSILRPDR VSPWDMEPLV  360
AATPTNTQPP QRNKRARPSV LPSPVQELPA LGMWKSPVDS PSSFSYCDPS RGRDLYPSPK  420
LSSAAKGLGY GENGSMPLST KTMYWSSQSE TCTESVAPAS EKRPANGCRL FGIELLDCPT  480
IDESSSVAMP SAVVEDQPVP SLNVDSDRNS EPSNPIPSVS CEPEKSSLRS THESQSKQIR  540
SCTKVHMQGK AVGRAVDLTR LDSYEDLLKK LEVMFEIEGE LRGSTKKWQV VYTDDEDDMM  600
MVGDDPWHEF CSMVRKIYVY TAEEAKKLSP KIKLPVVDVK PVSDGATVGN NEKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.053593355Auxin response factor 1
4ldw_A0.053593355Auxin response factor 1
4ldw_B0.053593355Auxin response factor 1
4ldx_A0.053593355Auxin response factor 1
4ldx_B0.053593355Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0137110.0BT013711.1 Lycopersicon esculentum clone 132555F, mRNA sequence.
GenBankHM0611540.0HM061154.1 Solanum lycopersicum auxin response factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234871.20.0auxin response factor 1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLK4B1N10.0K4B1N1_SOLLC; Auxin response factor
STRINGSolyc01g103050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA58381923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1